PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64349.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 201aa    MW: 22925.7 Da    PI: 11.4212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64349.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.2e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
       EPS64349.1 15 KGPWTKEEDQKLLAYIREHGHGRWRSLPAKAGLQRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.35.4e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E++ +++++++lG++ W++Ia++++ +Rt++++k++w++
       EPS64349.1  68 RGKFSMQEEKAIIRLHALLGNR-WSAIAAHLP-KRTDNEIKNYWNT 111
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-24965IPR009057Homeodomain-like
PROSITE profilePS5129424.711066IPR017930Myb domain
SuperFamilySSF466894.31E-3013109IPR009057Homeodomain-like
SMARTSM007171.5E-141464IPR001005SANT/Myb domain
PfamPF002492.4E-161562IPR001005SANT/Myb domain
CDDcd001675.53E-111762No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2666117IPR009057Homeodomain-like
SMARTSM007174.9E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129419.17167117IPR017930Myb domain
PfamPF002492.5E-1568111IPR001005SANT/Myb domain
CDDcd001671.26E-970113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGNQSNGQEK TALKKGPWTK EEDQKLLAYI REHGHGRWRS LPAKAGLQRC GKSCRLRWTN  60
YLRPDIKRGK FSMQEEKAII RLHALLGNRW SAIAAHLPKR TDNEIKNYWN TRLKKRLTRM  120
GIDPATHKPK ASPIGSGQSR QVAAVSHMAQ WETARLEAEA RLVRESKLLS RIQLLRRNSA  180
SPMMPAAAPP PPCLDVLKVW Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071274.11e-110PREDICTED: transcription factor MYB28-like
SwissprotQ8GWP04e-63MYB39_ARATH; Transcription factor MYB39
SwissprotQ9SPG52e-63MYB76_ARATH; Transcription factor MYB76
TrEMBLS8CBS11e-147S8CBS1_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0008s08870.13e-98(Populus trichocarpa)
STRINGGLYMA20G04240.23e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-93myb domain protein 106
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]