PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS64015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 282aa    MW: 32233.7 Da    PI: 6.2377
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS64015.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-172168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l+++++ +G g+W++ +r+ g++Rt+k+c++rw++yl
       EPS64015.1 21 RGPWTIEEDFALINYIANHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding51.52.2e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       EPS64015.1  74 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2841668IPR017930Myb domain
SuperFamilySSF466891.24E-3018115IPR009057Homeodomain-like
SMARTSM007174.5E-132070IPR001005SANT/Myb domain
PfamPF002492.4E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-212275IPR009057Homeodomain-like
CDDcd001674.16E-102368No hitNo description
PROSITE profilePS5129423.24669123IPR017930Myb domain
SMARTSM007171.3E-1473121IPR001005SANT/Myb domain
PfamPF002494.5E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2376122IPR009057Homeodomain-like
CDDcd001674.83E-794117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MEHENGGINS QSEEEFSDLR RGPWTIEEDF ALINYIANHG EGRWNSLSRC AGLKRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KHAKQLKCDV NSKQFKDAMR YLWIPRLMEK IQVASAAEAG APAMTSSSST SSSAASDLSK  180
PNTEANDHQI LVGAGGVYTP GNSKAAVSSD SSFGSDPMES LFYRDYNYDH HFCYGDQNMM  240
NGPTAYYDQG LDLVDQWMDG GDAQGYFWND DIWFLQHQFN TQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241812124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027944.11e-108PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-81MY108_ARATH; Transcription factor MYB108
TrEMBLS8CAY00.0S8CAY0_9LAMI; Uncharacterized protein
STRINGPOPTR_0008s10080.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.15e-86myb domain protein 78
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]