PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS63473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family CO-like
Protein Properties Length: 298aa    MW: 32831.2 Da    PI: 7.2767
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS63473.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.42.2e-061758437
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg........H 37
                r C++++   + lfC++++++lC  C +  H+g        H
  EPS63473.1 17 RLCTHCQAAAAVLFCRTDSTFLCICCDSMLHEGeggrenilH 58
                78******99******************99987666666666 PP

2zf-B_box30.38.7e-1060106242
    zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 + ++C+ +e+ ++ + C+ +   lC+dC  ++H+       H++vp+
  EPS63473.1  60 KVWICQVCEQFPAAFTCKADAAALCDDCDGHIHSAnplagrHDRVPV 106
                 5789*****************************66999999999986 PP

3CCT67.14.7e-23234277144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  EPS63473.1 234 REARVSRYREKRKKRKFEKTIRYASRKAYAETRPRIKGRFAKRT 277
                 9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.281456IPR000315B-box-type zinc finger
PROSITE profilePS501199.2431463IPR000315B-box-type zinc finger
CDDcd000213.67E-51749No hitNo description
SMARTSM003366.1E-1259106IPR000315B-box-type zinc finger
PROSITE profilePS501199.42859106IPR000315B-box-type zinc finger
PfamPF006433.2E-760106IPR000315B-box-type zinc finger
CDDcd000212.79E-662106No hitNo description
PROSITE profilePS5101716.658234276IPR010402CCT domain
PfamPF062031.3E-17234276IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGIFAAVRPR LLPPASRLCT HCQAAAAVLF CRTDSTFLCI CCDSMLHEGE GGRENILHEK  60
VWICQVCEQF PAAFTCKADA AALCDDCDGH IHSANPLAGR HDRVPVVPFH HLAETVALNS  120
GYREDGAWAT DGDVKPMELL LHESELLDFD HYCQPYGDLV VPVQAPANRP VPVAHDFLPE  180
NQFQFGSYNT TTPSLSHSVT VSSSSMEYNT APESETSFRL SVAMTGSGNF TTDREARVSR  240
YREKRKKRKF EKTIRYASRK AYAETRPRIK GRFAKRTAAE SGAAAGLIFS LAGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.11e-79zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-60COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLS8DKV40.0S8DKV4_9LAMI; Uncharacterized protein
STRINGMigut.K00262.1.p9e-67(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-39CONSTANS-like 5
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]