PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TCP
Protein Properties Length: 93aa    MW: 10404.9 Da    PI: 10.7282
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62922.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.84.8e-352588265
         TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                +g+kdrhsk++T++g+RdRRvRl a++a++f+d+qd+LG+d++sk+++WL+++ak ai+el+++
  EPS62922.1 25 TGRKDRHSKVCTAKGPRDRRVRLAAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKNAIDELAEL 88
                79***********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.6E-322587IPR005333Transcription factor, TCP
PROSITE profilePS5136932.9792785IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
PSRLGPRSGA GEIVEVQGGH IVRSTGRKDR HSKVCTAKGP RDRRVRLAAH TAIQFYDVQD  60
RLGYDRPSKA VDWLIKKAKN AIDELAELPP WHP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277724.16e-55PREDICTED: transcription factor TCP4
SwissprotQ8LPR53e-53TCP4_ARATH; Transcription factor TCP4
TrEMBLS8DSZ84e-63S8DSZ8_9LAMI; Uncharacterized protein (Fragment)
STRINGGLYMA06G34330.12e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66072234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.32e-54TCP family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]