PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 372aa    MW: 42201.2 Da    PI: 10.0422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62519.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-17453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++I+++mg  ++R +k+c +rw +yl
       EPS62519.1  4 RQRWQPEEDSLLRAYVKQYGPKEWNLISQRMGrvLNRDPKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding33.41e-1059103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
       EPS62519.1  59 KGSLTVEEQNLVISLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.602157IPR017930Myb domain
SMARTSM007172.1E-14355IPR001005SANT/Myb domain
SuperFamilySSF466891.16E-22498IPR009057Homeodomain-like
CDDcd001676.16E-10653No hitNo description
Gene3DG3DSA:1.10.10.601.2E-20660IPR009057Homeodomain-like
PfamPF139211.6E-14767No hitNo description
SMARTSM007171.4E-958106IPR001005SANT/Myb domain
PROSITE profilePS5129417.92458108IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-1561108IPR009057Homeodomain-like
CDDcd001671.82E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MKDRQRWQPE EDSLLRAYVK QYGPKEWNLI SQRMGRVLNR DPKSCLERWK NYLKPGIKKG  60
SLTVEEQNLV ISLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQLKQ LQKSRRTLPD  120
SGESTTENAA SQGKYDHILE TFAEKYVQPK LLAGFHPQAQ AQSGIVIPAV NLPPMVAEAS  180
PLVLSLASAP ATAAVDPAIL PPWMKVNCST TSTSSLASSS SPTAAASPSV SLTLSPSEPA  240
VFDPEIPPVP RSFHFQHVAA LIQDLDEGKE NWIRHKKEAT WRLSRLEQQL ESEKARRRRE  300
KTEEIEAEIR RLRDEEAAYS ARLEAECREQ LTAVRRDADD TEAKLMETWR SKHVKMVKLL  360
KQIGPHFNFH GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-15792789MYB PROTO-ONCOGENE PROTEIN
1msf_C6e-15792789C-Myb DNA-Binding Domain
1mse_C6e-15792789C-Myb DNA-Binding Domain
1h8a_C1e-1479230112MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295300RRRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097206.11e-153PREDICTED: protein rough sheath 2 homolog
TrEMBLS8C6X30.0S8C6X3_9LAMI; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29332445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-63MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]