PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 164aa    MW: 19036.4 Da    PI: 5.7456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62442.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.52.7e-07143445
                     S-HHHHHHHHHH.HHHTTTT.-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvda.vkqlGgg.tWktIartmgkgRtlkqcksrwq 45
                     WT  Ed+l+  + v+ +G +  W++Ia+++g ++++ ++  ++ 
       EPS62442.1  1 WTWKEDKLFETYlVEFYGCPdIWEKIAAKLG-TKSPAEIERHFE 43
                     *********98625556666***********.*********996 PP

2Myb_DNA-binding49.41.1e-1592137247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+ l++ + +++G+g+Wk+I+r+m ++R + q+ s+ qk+
       EPS62442.1  92 KPWTEEEHRLFLLGLEKFGKGDWKSISRYMVQTRNPTQVASHAQKH 137
                      58******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.345150IPR017884SANT domain
SMARTSM007171.4148IPR001005SANT/Myb domain
SuperFamilySSF466892.55E-7149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-5146IPR009057Homeodomain-like
CDDcd001672.06E-6146No hitNo description
PROSITE profilePS5129417.14386142IPR017930Myb domain
SuperFamilySSF466892.62E-1787143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-1187145IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1589141IPR006447Myb domain, plants
SMARTSM007173.5E-1290140IPR001005SANT/Myb domain
PfamPF002491.3E-1292137IPR001005SANT/Myb domain
CDDcd001671.42E-993138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
WTWKEDKLFE TYLVEFYGCP DIWEKIAAKL GTKSPAEIER HFEVLVEDVD AIEAGLIDPP  60
DYEDKDVSNS PEPQKNPKSD KKPVPVQRKA GKPWTEEEHR LFLLGLEKFG KGDWKSISRY  120
MVQTRNPTQV ASHAQKHFER QEKEEANKKR RSIFDCSISE GTSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095585.12e-83PREDICTED: transcription factor DIVARICATA-like
TrEMBLS8DRM71e-119S8DRM7_9LAMI; Uncharacterized protein (Fragment)
STRINGBra005818.1-P3e-43(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1498869
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-35MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]