PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 117aa    MW: 13448.5 Da    PI: 10.8589
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62440.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +v+q+G g+W ++++  g+ R+ k+c++rw +yl
       EPS62440.1 14 KGPWTPEEDILLVSYVQQHGAGNWIAVPSNAGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.51.1e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++Ed+ +v++ ++lG++ W++Ia++++  Rt++++k++w++
       EPS62440.1  67 RGNFTEQEDKTIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.218961IPR017930Myb domain
SuperFamilySSF466891.08E-3111108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002494.3E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-251568IPR009057Homeodomain-like
CDDcd001671.33E-101661No hitNo description
PROSITE profilePS5129424.24262116IPR017930Myb domain
SMARTSM007177.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2569115IPR009057Homeodomain-like
CDDcd001672.34E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGRPPFSNKI GVKKGPWTPE EDILLVSYVQ QHGAGNWIAV PSNAGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEQEDKTIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT RLKKKKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28141157107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438755.19e-73PREDICTED: myb-related protein 306
SwissprotP813927e-73MYB06_ANTMA; Myb-related protein 306
TrEMBLS8C6N12e-83S8C6N1_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_17s0000g06190.t015e-72(Vitis vinifera)
STRINGSolyc03g116100.2.16e-72(Solanum lycopersicum)
STRINGPGSC0003DMT4000502877e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.23e-73myb domain protein 96
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]