PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GeBP
Protein Properties Length: 750aa    MW: 83992.3 Da    PI: 9.437
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62439.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57369.19.3e-2282173397
      DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 ++r +s+eDei+lL+G   f a +g    + + +f++fvk+s+s ++sk q+ eKir+LKkKf+ + ++a ++ e++ s++h++  fels+ +Wg
  EPS62439.1  82 SSRKFSDEDEIALLKGHRAFWA-NG--RNQKWAEFHSFVKNSLSRDFSKGQVYEKIRKLKKKFEANLERALENGEIDHSEPHETLLFELSMTLWG 173
                 6799***************955.45..4589**************************************999**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.6E-2183173IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MAPENGEADR MNLSASTEGS LSGDEFREGG GHSTPLSSPK FKSPPAHKSF LDSSQCSSPS  60
ASDFIVLPVP KSDAKRKAPP ASSRKFSDED EIALLKGHRA FWANGRNQKW AEFHSFVKNS  120
LSRDFSKGQV YEKIRKLKKK FEANLERALE NGEIDHSEPH ETLLFELSMT LWGNECKVTE  180
ELQIPAESKH HEETTEIEAH DGKKTLELGE SIEEVKASVE MDENSNVSKR RKKSKNHEDP  240
IEQLKASAER DENPTFVKKK KKKKKTTVID SHDGKNILEA GVSVDELRSS EGREEDFASL  300
KRTKNENFEV DKAVKGSAAP LRKKKTTESE SRDEVDESSA AHKEIKKTEN KKDEGKKSQK  360
EASTGRDENS SVVSKEIKNT LQTDEAIEEL NASAKGKDEN PTLFKEKKKN KKIEGKNHDG  420
KRSLEVDKPD VSSSVHKEMN KTRNLNDERK KAQKTTSVGR HENSPVVSKE VKGTESKDHH  480
GKDNTLQADM ATEELNPPVV KDENPTVDKE KKKQRKIKRS AAASKEMKKT EAEMDEVKTS  540
PLKASSSVGT GKKDEISSDV SKAASKNHHD KKTLQAIEES KSSSAVLKKR KFDSKNRDGK  600
KALVVDEPAR QLTTTSVGSY ENSAAPERKN NSISSTIEEK KSHHDNEGNK IPSTRNKTKA  660
DKKPDKKDQG GKISTAEGDG SKEEFESDFP LLRASFDVDP YTRKMFFSIG REERTELEEE  720
WKEIRDMELS LYNRRVALIR THLLSNGGRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258264KKKKKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8C6P60.0S8C6P6_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13664413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.12e-11DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]