PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family NAC
Protein Properties Length: 252aa    MW: 28742.8 Da    PI: 9.2267
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62404.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.6e-50141581128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...................kvkaeekewyfFskrdkkyatgkrknratks 80 
                 lppGfrF Ptdeel+v+yL++k++g ++ l ++i ++d+yk++PwdLp+                   k+  +ekewyfFs+rd+ky++g+r+nr++ +
  EPS62404.1  14 LPPGFRFYPTDEELLVQYLCRKIAGYRFAL-QIIGDIDLYKFNPWDLPSklrirflggllslnfwcsdKALFGEKEWYFFSPRDRKYPNGSRPNRVAGA 111
                 79*************************999.89***************548999999999998887664445999************************ PP

         NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 gyWkatg+dk +++ +g++vg+kk Lvfy+g+ap+g+kt+W+mheyrl
  EPS62404.1 112 GYWKATGTDKIITT-EGRKVGIKKALVFYTGKAPRGTKTNWIMHEYRL 158
                 **********9999.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-609181IPR003441NAC domain
PROSITE profilePS5100558.25214181IPR003441NAC domain
PfamPF023651.5E-2515158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MVIRETDPML KLQLPPGFRF YPTDEELLVQ YLCRKIAGYR FALQIIGDID LYKFNPWDLP  60
SKLRIRFLGG LLSLNFWCSD KALFGEKEWY FFSPRDRKYP NGSRPNRVAG AGYWKATGTD  120
KIITTEGRKV GIKKALVFYT GKAPRGTKTN WIMHEYRLWE PAKKNSGTRL DDWVLCRIYE  180
KKSNGQKPAT DGGSPTSSSS LYDDVLDSWP ELNAGGFFNH LPCFDMVEDQ KPDQLGFNWA  240
SGSGLGPFGP EV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-9711874171NO APICAL MERISTEM PROTEIN
1ut4_B7e-9711874171NO APICAL MERISTEM PROTEIN
1ut7_A7e-9711874171NO APICAL MERISTEM PROTEIN
1ut7_B7e-9711874171NO APICAL MERISTEM PROTEIN
4dul_A7e-9711874171NAC domain-containing protein 19
4dul_B7e-9711874171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095243.11e-108NAC domain-containing protein 72
SwissprotQ93VY31e-102NAC72_ARATH; NAC domain-containing protein 72
TrEMBLS8C6M20.0S8C6M2_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.M00863.1.p1e-105(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.31e-102NAC family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  3. Li S, et al.
    The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence.
    Plant Cell Rep., 2016. 35(8): p. 1729-41
    [PMID:27154758]
  4. Ye H, et al.
    RD26 mediates crosstalk between drought and brassinosteroid signalling pathways.
    Nat Commun, 2017. 8: p. 14573
    [PMID:28233777]