PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TALE
Protein Properties Length: 440aa    MW: 48704.8 Da    PI: 7.8988
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62339.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-082402771954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp   ++  LA+++gL+ +qV++WF N R +
  EPS62339.1 240 FEHflHPYPCDVDKHILARQTGLSRSQVSNWFINARVR 277
                 5544589*****************************88 PP

2BELL109.12.6e-35103171472
        BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 elq +k+kLl++ +eVd+rY++y +q+++v++sFeavag gsa++Yt++A+ka+SrhFrcL+d i+  i
  EPS62339.1 103 ELQTRKSKLLHMSDEVDRRYRHYTDQMKAVVGSFEAVAGAGSARVYTTMASKAMSRHFRCLRDGIVREI 171
                 89***************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-4738169IPR006563POX domain
PfamPF075268.0E-4143167IPR006563POX domain
PROSITE profilePS5007111.483218281IPR001356Homeobox domain
SMARTSM003897.9E-9221285IPR001356Homeobox domain
CDDcd000865.11E-11221282No hitNo description
SuperFamilySSF466897.7E-17222288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-27224287IPR009057Homeodomain-like
PfamPF059207.9E-17238277IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
VFPCEGSERP SRGLSLSLNS SNPAAVTLQS FELRQARSPQ VAVLAGSRYL LPAQHLLAEF  60
CNLHAEEAKT EPPPQRINEC DGDGDDDEGA VKRQSLYASG VLELQTRKSK LLHMSDEVDR  120
RYRHYTDQMK AVVGSFEAVA GAGSARVYTT MASKAMSRHF RCLRDGIVRE IRVLKKAMGE  180
RDGGGGGGAS KGETPRLRIL DQKLRQQRAL QQMSMMETHP WRPQRGLPER AVSVLRAWLF  240
EHFLHPYPCD VDKHILARQT GLSRSQVSNW FINARVRLWK PMVEEMYREE VKESEADDRG  300
GGGGGGRRND DRKPSQDQLM TGIDSDCLSY IINNAKTKNK GAILHQNPVA FADGGHQMVG  360
FDFSSYAGQH AAAPPSNYGV SLTLGLHQHG GGGFPPATAP PSMFDQMEDC QNAHFSLLDS  420
DNQTLHYRNL MGAQLLHDLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A3e-16227285159Homeobox protein Meis2
5bng_B3e-16227285159Homeobox protein Meis2
4xrm_B3e-16227285563Homeobox protein Meis2
4xrm_A3e-16227285563Homeobox protein Meis2
4xrs_B3e-16227284158Homeobox protein Meis1
4xrs_A3e-16227284158Homeobox protein Meis1
3k2a_B3e-16227288566Homeobox protein Meis2
3k2a_A3e-16227288566Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298306RGGGGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080922.11e-162PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016440234.11e-162PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016440235.11e-162PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-110BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLS8C6I20.0S8C6I2_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0003s13120.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-104TALE family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]