PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TALE
Protein Properties Length: 194aa    MW: 22806.2 Da    PI: 9.9681
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62050.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.62.9e-101411781954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps++++  L++++gL+++qV++WF N R +
  EPS62050.1 141 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 178
                 554459******************************98 PP

2BELL1131.6e-36171171
        BELL  1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71
                er+e q++k kLls+l+eV++rY +y+eq+q v++sF++v+g+g+a+pYt+lA+ka+SrhFrc+kdaia  
  EPS62050.1  1 ERTEYQRRKIKLLSMLDEVENRYVRYCEQMQSVVNSFDTVIGHGAAAPYTTLAQKAMSRHFRCMKDAIAAE 71
                789*****************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075264.4E-33169IPR006563POX domain
SMARTSM005746.3E-13170IPR006563POX domain
Gene3DG3DSA:3.40.47.106.4E-4874IPR016039Thiolase-like
PROSITE profilePS5007112.357119182IPR001356Homeobox domain
SMARTSM003899.7E-9122186IPR001356Homeobox domain
CDDcd000863.30E-10122183No hitNo description
SuperFamilySSF466891.2E-17123189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-29125188IPR009057Homeodomain-like
PfamPF059201.3E-18139178IPR008422Homeobox KN domain
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003824Molecular Functioncatalytic activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
ERTEYQRRKI KLLSMLDEVE NRYVRYCEQM QSVVNSFDTV IGHGAAAPYT TLAQKAMSRH  60
FRCMKDAIAA ELKSTCDLLG EKDAAGLNAP TKGETPRLKL LEQRFRRQKS LQHMSMLQPE  120
SWRPQRGLPE RSVNLLRSWL FEHFLHPYPS EADKHLLSRQ TGLSKNQVSN WFINARVRLW  180
KPMVEEMYQQ ELQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-17128186563Homeobox protein Meis2
3k2a_A2e-17128186563Homeobox protein Meis2
4xrm_B2e-17128186563Homeobox protein Meis2
4xrm_A2e-17128186563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568677.11e-113PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-107BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLS8C5G71e-145S8C5G7_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc04g079830.2.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-108BEL1-like homeodomain 2
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]