PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61722.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 145aa    MW: 16633.9 Da    PI: 10.397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61722.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161763248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+W+ eEd++l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
       EPS61722.1 17 GPWSVEEDDRLISFIRKHGHSNWRALPKQAGLSRCGKSCRLRWINYL 63
                     89*******************************************97 PP

2Myb_DNA-binding60.24.4e-1969114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+++++d+++ lG++ W++Ia+ ++ gRt++++k+ w++yl
       EPS61722.1  69 RGNFTPEEEQRIIDLHASLGNK-WSKIASQLP-GRTDNEIKNVWNTYL 114
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2971163IPR017930Myb domain
SuperFamilySSF466896.25E-3114110IPR009057Homeodomain-like
SMARTSM007173.4E-131565IPR001005SANT/Myb domain
PfamPF002491.2E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241770IPR009057Homeodomain-like
CDDcd001672.78E-101863No hitNo description
PROSITE profilePS5129427.06264118IPR017930Myb domain
SMARTSM007172.8E-1568116IPR001005SANT/Myb domain
PfamPF002491.7E-1769114IPR001005SANT/Myb domain
CDDcd001675.76E-1171114No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2871118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MGRGRTPCCD RSKVKTGPWS VEEDDRLISF IRKHGHSNWR ALPKQAGLSR CGKSCRLRWI  60
NYLRPDVKRG NFTPEEEQRI IDLHASLGNK WSKIASQLPG RTDNEIKNVW NTYLKKRVTL  120
RSSTYVEKKP EKSSTLECGD DSASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29171188108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579575.15e-70PREDICTED: myb-related protein 308-like
SwissprotP200249e-64MYB1_MAIZE; Myb-related protein Zm1
TrEMBLS8DPK41e-104S8DPK4_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000292352e-69(Solanum tuberosum)
STRINGfgenesh1_pg.C_scaffold_10014922e-69(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-70myb domain protein 63
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]