PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 107aa    MW: 12113.9 Da    PI: 9.341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61700.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+ +++++G+g +W + ++++g++R++k+c++rw++yl
       EPS61700.1 14 RGPWSPEEDDKLKSYIEKHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     89**********************************************7 PP

2Myb_DNA-binding32.61.8e-1069107242
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                      g +T+eEd l+  +    G++ W+ Ia+ ++ gRt++++k+
       EPS61700.1  69 GGFTEEEDNLICSLYITIGSR-WSIIAAQLP-GRTDNDIKN 107
                      569******************.*********.*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.121966IPR017930Myb domain
SuperFamilySSF466893.04E-2711107IPR009057Homeodomain-like
SMARTSM007172.3E-131364IPR001005SANT/Myb domain
PfamPF002491.4E-171462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-261569IPR009057Homeodomain-like
CDDcd001673.59E-101662No hitNo description
PROSITE profilePS5129412.87467107IPR017930Myb domain
SMARTSM007170.5967107IPR001005SANT/Myb domain
PfamPF002494.2E-969107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-1870107IPR009057Homeodomain-like
CDDcd001674.97E-671107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDDKLKSYIE KHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNLIC SLYITIGSRW SIIAAQLPGR TDNDIKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2214107798B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550958.11e-75PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y94e-72RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0B2P2L91e-75A0A0B2P2L9_GLYSO; Transcription factor RAX3
TrEMBLI1MVH61e-75I1MVH6_SOYBN; Uncharacterized protein
STRINGGLYMA17G16980.14e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-73myb domain protein 84