PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 148aa    MW: 16962.5 Da    PI: 10.0693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61416.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +++ +v+ +G+g+W+ ++++ g++R++k+c++rw +yl
       EPS61416.1 14 RGPWTPEEDAKILAYVASHGTGNWTFVPQKAGLNRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding538.2e-1770110446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T+eE++ +v++++  G++ W++Iar+++ gRt++++k++w++
       EPS61416.1  70 FTPEEEQCIVELHRTIGSR-WSLIARRLP-GRTDNDVKNYWNT 110
                      9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129427.412965IPR017930Myb domain
SuperFamilySSF466898.44E-3211108IPR009057Homeodomain-like
SMARTSM007172.8E-151363IPR001005SANT/Myb domain
PfamPF002494.5E-181461IPR001005SANT/Myb domain
CDDcd001676.33E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.5466116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002493.8E-1570110IPR001005SANT/Myb domain
CDDcd001673.14E-1170109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGRPPCCDKA NVKRGPWTPE EDAKILAYVA SHGTGNWTFV PQKAGLNRCG KSCRLRWTNY  60
LRPDLKHDGF TPEEEQCIVE LHRTIGSRWS LIARRLPGRT DNDVKNYWNT KLKKKLTKMG  120
IDPVTHKPFS QLFSEYGKIS MNSADPFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841337.11e-96PREDICTED: myb-related protein 308
SwissprotQ9LSI75e-77MYB35_ARATH; Transcription factor MYB35
TrEMBLS8CAN11e-109S8CAN1_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000220091e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-78MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]