PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 285aa    MW: 31681.4 Da    PI: 6.5975
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61331.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
       EPS61331.1 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding45.81.4e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia +++  Rt++++k++w+++l
       EPS61331.1  67 RGNFTPHEEGMIIHLQALLGNK-WAAIATYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SuperFamilySSF466891.72E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
CDDcd001675.81E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2465117IPR009057Homeodomain-like
SMARTSM007178.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.01866116IPR017930Myb domain
PfamPF002495.8E-1367112IPR001005SANT/Myb domain
CDDcd001671.70E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIATYLPQRT DNDIKNYWNT HLKKKLKMMQ  120
SEPQLAGDSA TYHQFMTKPP PYGERAAADE NNQNPSVYAS SAENISKLLE GWMMRSSSPN  180
QTSAASNYND DRSKFNQFSD RSQQIGIGIG HDELDCILSF DHNPTAGLDK SSCDSSQKGS  240
EGSGLVDSRG KIEGDDHPPL SFLEKWLLDE SAGHGEGAME LPSLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-24141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C6e-24141164105C-Myb DNA-Binding Domain
1mse_C6e-24141164105C-Myb DNA-Binding Domain
1h8a_C7e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069952.11e-126PREDICTED: myb-related protein 306
SwissprotP813922e-89MYB06_ANTMA; Myb-related protein 306
TrEMBLS8CAG20.0S8CAG2_9LAMI; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-98myb domain protein 60
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]