PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family LFY
Protein Properties Length: 278aa    MW: 31165.8 Da    PI: 4.6245
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61174.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY380.72.2e-11612781281
     FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifr 98 
                 mdp+afsaslfkwdpra     p rlle+ + ++ p  +aa +   r+l +leelf+ayG+ry+t+akiaelGftv+tL+dm+deeld++m+sls+ifr
  EPS61174.1   1 MDPDAFSASLFKWDPRAGLPL-PGRLLETVVPAALPpPQAAYSLRPRELGGLEELFQAYGIRYFTAAKIAELGFTVNTLLDMRDEELDEMMDSLSHIFR 98 
                 9***************88754.5566655554444324566667777799************************************************* PP

     FLO_LFY  99 ldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaee.kkseeekkkaskk.kqkr 195
                 +dllvGeryGikaavraerrrl+eee  ++rr++ls d+ + ldalsqeglseepvq+ekeaagsgg+    +e+v+a+      ++k++++k+ +  r
  EPS61174.1  99 WDLLVGERYGIKAAVRAERRRLDEEE--ARRRHFLSGDTPHPLDALSQEGLSEEPVQQEKEAAGSGGGA--VWEMVTAAGvGGVGARKQQRRKNyRGGR 193
                 ************************88..89999********************************9998..8888888773333333333333324444 PP

     FLO_LFY 196 kkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkv 281
                  ++ +++ ee++++ee+e  +++++  +g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefL+qvq+iakerGekcPtkv
  EPS61174.1 194 SRMASME-EEEDEDEETEGAEDDDNCGGGNERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQNIAKERGEKCPTKV 278
                 4444433.3444445555666666777799*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.5E-1221278IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDPDAFSASL FKWDPRAGLP LPGRLLETVV PAALPPPQAA YSLRPRELGG LEELFQAYGI  60
RYFTAAKIAE LGFTVNTLLD MRDEELDEMM DSLSHIFRWD LLVGERYGIK AAVRAERRRL  120
DEEEARRRHF LSGDTPHPLD ALSQEGLSEE PVQQEKEAAG SGGGAVWEMV TAAGVGGVGA  180
RKQQRRKNYR GGRSRMASME EEEDEDEETE GAEDDDNCGG GNERQREHPF IVTEPGEVAR  240
GKKNGLDYLF HLYEQCREFL IQVQNIAKER GEKCPTKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A8e-32221278259PROTEIN LEAFY
2vy2_A8e-32221278259PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtRequired for flower development. FLO may interact in a sequential manner with other homeotic genes affecting floral organ identity.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012856831.11e-140PREDICTED: floricaula protein-like
SwissprotP239151e-128FLO_ANTMA; Floricaula protein
TrEMBLS8C3D90.0S8C3D9_9LAMI; Uncharacterized protein (Fragment)
STRINGMigut.I00669.1.p1e-139(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-58floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Coen ES, et al.
    floricaula: a homeotic gene required for flower development in antirrhinum majus.
    Cell, 1990. 63(6): p. 1311-22
    [PMID:1702033]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]