PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60712.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WRKY
Protein Properties Length: 478aa    MW: 51526 Da    PI: 7.1535
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60712.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.71.6e-30195252260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers   ++++ei+Y+g+H h+k
  EPS60712.1 195 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-GGQITEIVYKGSHVHPK 252
                 8****************************************.***************85 PP

2WRKY106.21.7e-33364422159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+Hnh+
  EPS60712.1 364 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNSGCPVRKHVERASHDPKAVITTYEGKHNHD 422
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-26186253IPR003657WRKY domain
PROSITE profilePS5081121.907189253IPR003657WRKY domain
SuperFamilySSF1182907.98E-24192253IPR003657WRKY domain
SMARTSM007741.9E-32194252IPR003657WRKY domain
PfamPF031064.5E-23195251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37349424IPR003657WRKY domain
SuperFamilySSF1182901.83E-29356424IPR003657WRKY domain
PROSITE profilePS5081138.733359424IPR003657WRKY domain
SMARTSM007747.3E-39364423IPR003657WRKY domain
PfamPF031062.6E-26365422IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
SPAPDQAADN IGSISGAKYK LMSPAKLPIS RSTCITIPPG LSPTSFLESP VLLSYIKAEP  60
SPTTGSFFKP HVMPRTGENP ALPLENKFAA SKDVNGGTLN GFESQFHAGG SSTSGIPSAG  120
LQVPGVSNRN GPASDQDHCI SQAHTTLSSS SQAARGGDDS AVCRPTEGFI QEGLMASSDH  180
KDSVPSSASG ERTSDDGYNW RKYGQKLVKG SEFPRSYYKC TYPNCEVKKI FERSPGGQIT  240
EIVYKGSHVH PKPQAAARRQ SPAFPWSVPE DRLNKDFQFT GHEDKFNVNT ADQNGSPAVS  300
PLQANEDAAD GSQQPPLVNE DNDEDDPFLK KRKIEDCMDV TTPVVKPIRE PRVVVQTLSE  360
VDILDDGYRW RKYGQKVVRG NPNPRSYYKC TNSGCPVRKH VERASHDPKA VITTYEGKHN  420
HDVPAGRSNN NHDSGGGTPA APYVLTSKMR PPQDGGGGTS ITLDLGFGIG RTRTSDEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-37195425878Probable WRKY transcription factor 4
1wj2_A2e-37195425878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095503.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-135WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLS8DM790.0S8DM79_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000766701e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-136WRKY family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]