PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60436.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 300aa    MW: 32602.9 Da    PI: 5.7498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60436.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-18853147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed ll ++vk +G ++W++Iar ++ gR++k+c++rw + 
       EPS60436.1  8 KGPWSPDEDSLLNQLVKNHGARNWSLIARGIP-GRSGKSCRLRWCNQ 53
                     79******************************.***********985 PP

2Myb_DNA-binding55.41.4e-1760104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T +Ed ++++a++ +G++ W++Iar ++ gRt++ +k++w++ 
       EPS60436.1  60 RKAFTDDEDRIILEAHAVHGNK-WASIARLLP-GRTDNAIKNHWNST 104
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.846354IPR017930Myb domain
SuperFamilySSF466895.24E-305101IPR009057Homeodomain-like
SMARTSM007171.9E-14756IPR001005SANT/Myb domain
PfamPF002492.2E-17853IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-26961IPR009057Homeodomain-like
CDDcd001671.16E-141052No hitNo description
PROSITE profilePS5129427.58155109IPR017930Myb domain
SMARTSM007171.7E-1659107IPR001005SANT/Myb domain
PfamPF002492.9E-1560104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2362108IPR009057Homeodomain-like
CDDcd001678.61E-1362105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
KKSFDRVKGP WSPDEDSLLN QLVKNHGARN WSLIARGIPG RSGKSCRLRW CNQLDPSVKR  60
KAFTDDEDRI ILEAHAVHGN KWASIARLLP GRTDNAIKNH WNSTLKRRQV GKTKKSLLSN  120
TVEETRAASS GETPSLGDAN SLKSVDGKND AMNSVESRDD DTSHEEEEEE EEDEPLPENN  180
CHPTDHPTVF HPLSRASAFT AYNAVDSTPP PVVVRPTSHQ ASSASQQQPS DNTDAGIIKL  240
LEEANGESLV PLHCGHGCCE TSSGISPKKG GSVLGPEFMD YAESPSLTCH ELAALAADIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-4351084107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094946.11e-114PREDICTED: uncharacterized protein LOC105174515
TrEMBLS8C7U50.0S8C7U5_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc09g011780.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.15e-74myb domain protein 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]