PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 282aa    MW: 29567.5 Da    PI: 6.9698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60201.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.61.4e-081157347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT e d+++ +a+  +  +   +W+++a+++  g+++ ++++++  +
       EPS60201.1 11 VWTREQDKQFERAIVTYSDDcpdRWEKVASEVA-GKSAGEVRDHYEVL 57
                     7*****************99*************.***********876 PP

2Myb_DNA-binding42.12e-13116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       EPS60201.1 116 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 160
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.086760IPR017884SANT domain
SMARTSM007171.3E-7860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-5959IPR009057Homeodomain-like
SuperFamilySSF466892.62E-121066IPR009057Homeodomain-like
PfamPF002495.2E-71157IPR001005SANT/Myb domain
CDDcd001672.63E-81258No hitNo description
PROSITE profilePS5129417.581108165IPR017930Myb domain
SuperFamilySSF466891.2E-16111166IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-17113163IPR006447Myb domain, plants
SMARTSM007173.2E-10113163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10116159IPR009057Homeodomain-like
CDDcd001677.32E-10116161No hitNo description
PfamPF002492.5E-11116160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MPAEESSSSS VWTREQDKQF ERAIVTYSDD CPDRWEKVAS EVAGKSAGEV RDHYEVLLDD  60
VSRIESGFVE LPSYNSSSDG STSHAAEDGK KSNSGESNQG SGKSSRSDQE RRKGIAWTED  120
EHRLFLLGLD KYGKGDWRSI SRNFVVTRTP TQVASHAQKY FIRLNSMNKD RRRSSIHDIT  180
SVNVNAAGAG GGGGGGGGGD VPITGTAAAA SPGAKSNSGK HPPPPGIYGQ PTIGQPVGGP  240
LVSAVGTPVN LPPPGHMAAY GIPGGVVPGA PLTMPPATYH TP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1612771176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070471.11e-127PREDICTED: transcription factor DIVARICATA
RefseqXP_011070472.11e-127PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8C7150.0S8C715_9LAMI; Uncharacterized protein (Fragment)
STRINGGLYMA07G28310.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41492445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-102MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]