PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 123aa    MW: 14522.3 Da    PI: 7.1292
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60120.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.7e-122173557
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                ++ rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L ++l++ ++  +
  EPS60120.1 21 RKRRRMKSNRESARRSRMRKQRHLDELWSQVLRLRTENNHLLDKLNHVTQSHD 73
                56789999*************************************99988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-161781IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.3581982IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.63E-122171No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-112194No hitNo description
PfamPF001707.2E-102169IPR004827Basic-leucine zipper domain
CDDcd147027.14E-172273No hitNo description
PROSITE patternPS0003602439IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
ISNLSTNVED EGNQLSVVDE RKRRRMKSNR ESARRSRMRK QRHLDELWSQ VLRLRTENNH  60
LLDKLNHVTQ SHDRIVQENE KLKDEASDLH QMLMDIQFCN IFTCISDFED MSCNLTHLAA  120
AST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12024RKRRR
23340RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.15e-53basic leucine zipper 43
SwissprotQ9FMC22e-31BZP43_ARATH; Basic leucine zipper 43
TrEMBLS8BZT51e-83S8BZT5_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_009794536.13e-49(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-39basic leucine-zipper 42
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]