PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59589.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WRKY
Protein Properties Length: 406aa    MW: 44638.3 Da    PI: 7.9388
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59589.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.75.1e-33164220259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 dDgynWrKYGqK+vkg efprsYY+Ct+++Cpvkkkvers  +++++ei+Y+g+Hnh+
  EPS59589.1 164 DDGYNWRKYGQKQVKGGEFPRSYYKCTHPQCPVKKKVERSL-EGQITEIIYRGQHNHS 220
                 8****************************************.***************8 PP

2WRKY106.99.8e-34335393159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+ +k+ver+a+dpk+v++tYeg+Hnh+
  EPS59589.1 335 LDDGYRWRKYGQKVVKGNPYPRSYYKCTHPGCNIRKHVERAASDPKAVITTYEGKHNHD 393
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-28160222IPR003657WRKY domain
SuperFamilySSF1182901.03E-25161222IPR003657WRKY domain
SMARTSM007743.5E-35163221IPR003657WRKY domain
PROSITE profilePS5081122.492164222IPR003657WRKY domain
PfamPF031063.1E-25164219IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-37321395IPR003657WRKY domain
SuperFamilySSF1182904.45E-30327395IPR003657WRKY domain
PROSITE profilePS5081138.09330395IPR003657WRKY domain
SMARTSM007747.6E-39335394IPR003657WRKY domain
PfamPF031063.1E-26336393IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
PPITLPPRSA IESLFSGGTG ESPGPMTLVS SFFAENDPEN DCRSFSQLLA GPTDSPLQEP  60
PRPPPGVFPI PSGMSFANLL DSNPFDSRQL FFSSFSTWKQ TAFGPLHHQG FQSREAQSTL  120
PMKQQIPAAP PPLQDQQLLN NNESYDISFA DQKSRYLIID KPTDDGYNWR KYGQKQVKGG  180
EFPRSYYKCT HPQCPVKKKV ERSLEGQITE IIYRGQHNHS QPSKRTGNTN EAQGSNSAGF  240
GGSESQGGGK LVEEVSSYLS SAIRREQDHS QLKPEQVSGS SDSEGLDDAD TGANGAAPET  300
KRRYISLLVP NVSSSHRTVT EARIIVQTTS EVDLLDDGYR WRKYGQKVVK GNPYPRSYYK  360
CTHPGCNIRK HVERAASDPK AVITTYEGKH NHDVPPSKGS SSSSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-42164395878Probable WRKY transcription factor 4
1wj2_A1e-42164395878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070970.11e-144PREDICTED: probable WRKY transcription factor 3 isoform X2
SwissprotQ9ZQ701e-118WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLS8BYV40.0S8BYV4_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_01s0011g00220.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.21e-112WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]