PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 224aa    MW: 25019.2 Da    PI: 9.6441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59550.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +v+++G+g+W+++++  g++R+ k+c++rw +yl
       EPS59550.1 14 KGPWTPEEDIMLVSYVQEHGPGNWRAVPSNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.68.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ +v++  +lG++ W++Ia++++  Rt++++k++w+++l
       EPS59550.1  67 RGSFTDHEEKMIVQLQGLLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.553965IPR017930Myb domain
SuperFamilySSF466895.03E-3111108IPR009057Homeodomain-like
SMARTSM007172.7E-151363IPR001005SANT/Myb domain
PfamPF002493.7E-171461IPR001005SANT/Myb domain
CDDcd001674.56E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129418.69666116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002494.5E-1367112IPR001005SANT/Myb domain
CDDcd001678.70E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIMLVSYVQ EHGPGNWRAV PSNTGLRRCS KSCRLRWTNY  60
LRPGIKRGSF TDHEEKMIVQ LQGLLGNKWA AIASYLPERT DNDIKNYWNT HLKKKLKKLQ  120
SGDSCLSGAG ELFPAMLSKG QWERRLQTDI STAKQALHDA LSSETADKSF AGATPYASST  180
ENIARLLKQW MNEKPNSHNN NNNKSQCSSS TSNNRTAVDS SCSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-271411627128MYB TRANSFORMING PROTEIN
1mse_C2e-27141164105C-Myb DNA-Binding Domain
1msf_C2e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098622.11e-111PREDICTED: myb-related protein 306-like
SwissprotP813921e-100MYB06_ANTMA; Myb-related protein 306
TrEMBLS8BY731e-168S8BY73_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc03g116100.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.19e-98myb domain protein 94
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]