PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 134aa    MW: 15125.9 Da    PI: 10.2559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59267.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed  l d+v+ +G g+W+++    g+ R++k+c++rw ++l
       EPS59267.1 21 KGPWTSAEDAVLTDYVRNHGEGNWNSVQTQTGLARCGKSCRLRWANHL 68
                     79******************************************9996 PP

2Myb_DNA-binding54.82.2e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
       EPS59267.1  74 KGAFTSEEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 117
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9251668IPR017930Myb domain
SuperFamilySSF466894.12E-3019115IPR009057Homeodomain-like
SMARTSM007179.4E-102070IPR001005SANT/Myb domain
PfamPF002492.3E-132168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-242275IPR009057Homeodomain-like
CDDcd001675.32E-82368No hitNo description
PROSITE profilePS5129425.85969123IPR017930Myb domain
SMARTSM007172.3E-1673121IPR001005SANT/Myb domain
PfamPF002496.0E-1674117IPR001005SANT/Myb domain
CDDcd001679.21E-1276117No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2676122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
NDDDNSLGES SNGGKAVALK KGPWTSAEDA VLTDYVRNHG EGNWNSVQTQ TGLARCGKSC  60
RLRWANHLRP NLKKGAFTSE EERLIVELHA KMGNKWARMA AHLPGRTDNE IKNYWNTRIK  120
RRQRSGQPLY PPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31191225107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091874.11e-76PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_011091873.12e-76PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_011091872.12e-76PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_011091870.12e-76PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_011091869.12e-76PREDICTED: transcription factor GAMYB-like isoform X1
SwissprotA2WW879e-73GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC29e-73GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLS8DIK16e-97S8DIK1_9LAMI; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr1P17150_0012e-73(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-72myb domain protein 33
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]