PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 122aa    MW: 14321.4 Da    PI: 10.3246
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59067.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
       EPS59067.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPQKAGLQRCGKSCRLRWINYL 61
                     789*******************************************97 PP

2Myb_DNA-binding53.46.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T++E++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       EPS59067.1  67 RGRFTPDEEKLIITLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.18961IPR017930Myb domain
SuperFamilySSF466896.11E-3111108IPR009057Homeodomain-like
SMARTSM007172.8E-121363IPR001005SANT/Myb domain
PfamPF002493.8E-161461IPR001005SANT/Myb domain
CDDcd001671.17E-101761No hitNo description
PROSITE profilePS5129424.862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001671.16E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PQKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPDEEKLIIT LHGAVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRNPT  120
SP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074190.14e-85PREDICTED: transcription repressor MYB6
SwissprotQ8LPH62e-64MYB86_ARATH; Transcription factor MYB86
TrEMBLS8DI261e-87S8DI26_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0003s13190.13e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.16e-85myb domain protein 103
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]