PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 160aa    MW: 18176.4 Da    PI: 10.3009
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59038.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
       EPS59038.1 37 KGPWTSGEDAILIDYVNKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 84
                     79******************************************9996 PP

2Myb_DNA-binding52.31.3e-1690133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a +++ gRt++++k++w++
       EPS59038.1  90 KGAFTAEEERRIIELHAKMGNK-WARMATELP-GRTDNEIKNFWNT 133
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1333284IPR017930Myb domain
SuperFamilySSF466897.55E-3135131IPR009057Homeodomain-like
SMARTSM007177.5E-153686IPR001005SANT/Myb domain
PfamPF002493.1E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-253891IPR009057Homeodomain-like
CDDcd001676.03E-113984No hitNo description
PROSITE profilePS5129425.57785139IPR017930Myb domain
SMARTSM007171.1E-1589137IPR001005SANT/Myb domain
PfamPF002492.2E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2592138IPR009057Homeodomain-like
CDDcd001672.59E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
LKMSMTSDSD ERMVPQNSID SPSNNGENVG SNGPLKKGPW TSGEDAILID YVNKHGEGNW  60
NAVQKHSGLS RCGKSCRLRW ANHLRPDLKK GAFTAEEERR IIELHAKMGN KWARMATELP  120
GRTDNEIKNF WNTRIKRRQR AGLPIYPNYI SSQVKNESQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838472.18e-90PREDICTED: transcription factor GAMYB-like
RefseqXP_012838471.18e-90PREDICTED: transcription factor GAMYB-like
RefseqXP_012838470.18e-90PREDICTED: transcription factor GAMYB-like
RefseqXP_012838469.18e-90PREDICTED: transcription factor GAMYB-like
SwissprotA2WW871e-78GAM1_ORYSI; Transcription factor GAMYB
TrEMBLS8D8L61e-117S8D8L6_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc06g073640.2.18e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.15e-72myb domain protein 65
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]