PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58795.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family G2-like
Protein Properties Length: 230aa    MW: 25115.8 Da    PI: 7.7324
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58795.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-3280133255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+a+e+LGG+e+AtPk++l+lm+v gL+++hvkSHLQ+YR+
  EPS58795.1  80 PRLRWTPDLHLSFVHAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQMYRS 133
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.40976136IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2976134IPR009057Homeodomain-like
SuperFamilySSF466897.17E-1578134IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2380135IPR006447Myb domain, plants
PfamPF002491.1E-881132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDDVKMEVSR EEAADNALSD SSENISSIDL NEEAGSNVVG EPNRDENETV GEKSCDVSSK  60
SGEGNERKTN VRQYIRSKMP RLRWTPDLHL SFVHAIERLG GQERATPKAV LQLMNVRGLS  120
ISHVKSHLQM YRSKKLDESG KVIGQGNRVY GIHGRNHFVS AASYGGKFSS AASPLNQLKL  180
ENGGIVFVTE SGPNLSAAGH DCLRSFSSYG SSQTHYTFDS SVKTPLPSSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-1981135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1981135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1981135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1981135357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.18e-73myb-related protein 2
RefseqXP_020546992.18e-73myb-related protein 2
TrEMBLS8BVZ61e-169S8BVZ6_9LAMI; Uncharacterized protein
STRINGMigut.M01030.1.p4e-58(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-39G2-like family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]