PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family bZIP
Protein Properties Length: 316aa    MW: 35739.7 Da    PI: 8.3464
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58512.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.6e-112464545
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45
                k  rr+++NReAAr+sR+RKka++++Le+    L++  ++L
  EPS58512.1 24 KTLRRLAQNREAARKSRLRKKAYVQQLETSRMRLTQLEQEL 64
                7789************************9777776665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-91966No hitNo description
SMARTSM003381.8E-92083IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.3122266IPR004827Basic-leucine zipper domain
PfamPF001702.3E-82464IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-82467No hitNo description
CDDcd147089.59E-222476No hitNo description
PROSITE patternPS0003602742IPR004827Basic-leucine zipper domain
PfamPF141446.5E-30117190IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
QGNRKGASAA TTSEHDGPKT PDPKTLRRLA QNREAARKSR LRKKAYVQQL ETSRMRLTQL  60
EQELQRARSQ GLYLGGQAAL VGGDQGLPVS MANMNSDATL FDMEYARWQE EHHRIVEELR  120
KAVSDQVPEN DLRIFVDNCV GHYDHVLNLK GMIAKSDVFH LLSGMWKTPA ERCFMWIGGF  180
RPSELIKIVA REVEEMTEHQ LMGICGLQQT TQDAEDALSQ GLDTLNQSLS QAIIADSLAV  240
PPNMNSYMSQ MALAITKLST LEAFITQADS LRHQTLHRLH QILTTRQSAR CFLAMAEYFH  300
RLRALSSLWL ARPRQD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00491DAPTransfer from AT5G06839Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075176.10.0PREDICTED: transcription factor HBP-1b(c38)
SwissprotP239231e-122HBP1B_WHEAT; Transcription factor HBP-1b(c38)
SwissprotQ415581e-121HBP1C_WHEAT; Transcription factor HBP-1b(c1) (Fragment)
TrEMBLS8DGL50.0S8DGL5_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_08s0007g06160.t011e-170(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22792145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06839.11e-148bZIP family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]