PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58458.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 109aa    MW: 12839.9 Da    PI: 10.4332
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58458.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181962448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     WT eEd+ll ++v+++ g++Wk++a++++ +Rt+ qc +rwqk+l
       EPS58458.1 19 WTHEEDKLLTELVQRYKGKNWKKVAACLP-RRTDVQCLHRWQKVL 62
                     *****************************.************986 PP

2Myb_DNA-binding48.71.7e-1568109143
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      + +WT+eEd+ +++ v+++G ++W++Ia+ ++ gR +kqc++r
       EPS58458.1  68 KSPWTKEEDDCIIKSVEKYGCRRWSAIAKVLP-GRIGKQCRER 109
                      679*****************************.********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.123862IPR017930Myb domain
SMARTSM007175.2E-141564IPR001005SANT/Myb domain
CDDcd001671.34E-121962No hitNo description
Gene3DG3DSA:1.10.10.604.8E-241969IPR009057Homeodomain-like
PfamPF139211.5E-181976No hitNo description
SuperFamilySSF466892.29E-2442109IPR009057Homeodomain-like
PROSITE profilePS5129424.49863109IPR017930Myb domain
SMARTSM007171.0E-667109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2170109IPR009057Homeodomain-like
CDDcd001679.05E-1270109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
CRISEGRFVS VRRSSQAGWT HEEDKLLTEL VQRYKGKNWK KVAACLPRRT DVQCLHRWQK  60
VLNPDLNKSP WTKEEDDCII KSVEKYGCRR WSAIAKVLPG RIGKQCRER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-36191099142MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-36191099142MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081002.13e-49PREDICTED: uncharacterized protein LOC105164125
SwissprotQ9S7G72e-41MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLS8D7322e-75S8D732_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc08g080580.2.13e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1935033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.25e-44Homeodomain-like protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]