PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 134aa    MW: 15073.4 Da    PI: 10.3783
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58210.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.8e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d++++ G+g +W + ++++g++R++k+c++rw++yl
       EPS58210.1 14 KGPWSPEEDAKLKDYINKNGTGgNWIALPHKVGLKRCGKSCRLRWLNYL 62
                     79**********************************************7 PP

2Myb_DNA-binding42.61.4e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd+++  + +  G++ W+ Ia+ ++ gRt++++k++w++
       EPS58210.1  69 GEFSDEEDKIICSLYATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.287962IPR017930Myb domain
SuperFamilySSF466891.24E-2711109IPR009057Homeodomain-like
SMARTSM007171.4E-121364IPR001005SANT/Myb domain
PfamPF002496.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-251569IPR009057Homeodomain-like
CDDcd001674.41E-91662No hitNo description
PROSITE profilePS5129421.62563117IPR017930Myb domain
SMARTSM007172.4E-1267115IPR001005SANT/Myb domain
PfamPF002492.0E-1269111IPR001005SANT/Myb domain
CDDcd001671.59E-870113No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIN KNGTGGNWIA LPHKVGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDKIIC SLYATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGI  120
SIPASSSQRR NAAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838332.18e-82PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL22e-78MYB36_ARATH; Transcription factor MYB36
TrEMBLS8BUC51e-95S8BUC5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0006s12530.12e-79(Populus trichocarpa)
STRINGSolyc09g008250.2.12e-79(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-79myb domain protein 36
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]