PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TALE
Protein Properties Length: 459aa    MW: 52087.6 Da    PI: 8.1775
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58139.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.72e-082653021954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp   ++  LA+++gL+ +qV++WF N R +
  EPS58139.1 265 FEHflHPYPCDVDKHILARQTGLSRSQVSNWFINARVR 302
                 5544589*****************************88 PP

2BELL108.34.7e-35130200272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   elq++k+kLl++l+eVd+rY++y++q+++v +sFea+ag g+a++Y ++A+ka+SrhFrcL+d ia qi
  EPS58139.1 130 VIELQRRKSKLLQMLDEVDNRYRHYCDQMKAVNASFEAIAGDGAARVYSRMASKAMSRHFRCLRDGIAMQI 200
                 579*****************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-4771198IPR006563POX domain
PfamPF075267.0E-4277197IPR006563POX domain
PROSITE profilePS5007111.467243306IPR001356Homeobox domain
CDDcd000861.00E-9246307No hitNo description
SMARTSM003891.5E-8246310IPR001356Homeobox domain
SuperFamilySSF466891.03E-16247313IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-27249312IPR009057Homeodomain-like
PfamPF059208.3E-17263302IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
HRPFLSDDPS LRCVFPCEGN ERPSQGLSLS LNSSNPAAIG VQPFELRQHH HHDSRFGQAA  60
SSRSSQVSVQ TQTFSLLRNS KYLGPAQDLL NQFCNLAGDA ESEKTLKSYK NTETEEEDAV  120
NRQALYSLDV IELQRRKSKL LQMLDEVDNR YRHYCDQMKA VNASFEAIAG DGAARVYSRM  180
ASKAMSRHFR CLRDGIAMQI RSVRKAMGEK DCGMSKGETP RLRLLDQTLR QQRALQQMSM  240
METHPWRPQR GLPERAVSML RAWLFEHFLH PYPCDVDKHI LARQTGLSRS QVSNWFINAR  300
VRLWKPMVEE MYREELKESE TGQKDPDQKP TRQHFRRTDS ECLSSIINAD DKNGGQRKNK  360
EAAAIHQNLT AFSSSSYGPQ MEMDFSSYAH RQPTGVSLTL GLHQHAGGGG GGLTFLPPAA  420
VFEQMEECQN QQFTLLESEN QTLPYRNLMG AQLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-15252313566Homeobox protein Meis2
3k2a_A3e-15252313566Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080922.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-116BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLS8BUT50.0S8BUT5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.15e-93TALE family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]