PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 243aa    MW: 26710 Da    PI: 9.2646
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57937.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53.2e-08651346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT eE +++ d+ + +  +   +W ++a+ ++ g++  ++ + ++ 
       EPS57937.1  6 AWTVEENKKFEDLLAVYDEKtpnRWFKVAKSIP-GKSVSDVMNQYRV 51
                     7********************************.**********986 PP

2Myb_DNA-binding40.75.4e-13116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + +++G+g+W++I+r     +t+ q+ s+ qky
       EPS57937.1 116 PWTEDEHRRFLLGLQKHGKGDWRSISRNYVISKTPTQVASHAQKY 160
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.91256IPR017884SANT domain
SMARTSM007172.6E-9355IPR001005SANT/Myb domain
CDDcd001672.53E-8652No hitNo description
PfamPF002498.7E-7651IPR001005SANT/Myb domain
SuperFamilySSF466891.59E-11660IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-4650IPR009057Homeodomain-like
PROSITE profilePS5129418.688109165IPR017930Myb domain
SuperFamilySSF466891.86E-15110164IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-18112164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.8E-11113165IPR009057Homeodomain-like
SMARTSM007171.6E-10113163IPR001005SANT/Myb domain
PfamPF002492.8E-11116160IPR001005SANT/Myb domain
CDDcd001675.93E-9116160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEEATAWTVE ENKKFEDLLA VYDEKTPNRW FKVAKSIPGK SVSDVMNQYR VLESDVCNIE  60
AGLIPIPVYL ASSSSSSSAA AAAASFTLKL AGGLEVYRKR SRDCAAHEQE RKKGVPWTED  120
EHRRFLLGLQ KHGKGDWRSI SRNYVISKTP TQVASHAQKY YQRQLSGRKD RRRPSIHDIT  180
IVNPSSSSAP PVSGAEIPSS MKNAVGEMGG GGFIVLNSDN AFANDDHFGF SISAAGYGFM  240
GFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-147721176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076737.12e-86PREDICTED: transcription factor DIVARICATA-like
RefseqXP_011076738.12e-86PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-73DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8DEZ40.0S8DEZ4_9LAMI; Myb family transcription factor
STRINGVIT_13s0019g03370.t011e-77(Vitis vinifera)
STRINGPGSC0003DMT4000534331e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.17e-75MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]