PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 276aa    MW: 31268.8 Da    PI: 8.7167
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57791.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.9e-081459346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT eE + + +a +++ ++   +W+ +a++++ g+t  +++  ++ 
       EPS57791.1 14 KWTVEENKMFENALALFDKDtpdRWHNVAAMVP-GKTVGDVIKQYRE 59
                     7********************************.*******999986 PP

2Myb_DNA-binding47.44.3e-15133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
       EPS57791.1 133 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.851065IPR017884SANT domain
SMARTSM007174.0E-91163IPR001005SANT/Myb domain
CDDcd001676.69E-71461No hitNo description
PfamPF002491.5E-61460IPR001005SANT/Myb domain
SuperFamilySSF466897.18E-121468IPR009057Homeodomain-like
PROSITE profilePS5129421.347126182IPR017930Myb domain
SuperFamilySSF466891.31E-17128181IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17129181IPR006447Myb domain, plants
SMARTSM007172.1E-13130180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-13130177IPR009057Homeodomain-like
CDDcd001672.14E-10133178No hitNo description
PfamPF002491.7E-12133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGSWEENKAA GAAKWTVEEN KMFENALALF DKDTPDRWHN VAAMVPGKTV GDVIKQYREL  60
VDDVTDIEAG LIPVPGYVNN SNTSNSSFTL EWVNDHRHRH FYTHPKRISS SSTSTTSTSS  120
RCSTEHERKK GVPWTEEEHR QFLMGLKKYG KGDWRNISRN FVTTRTPTQV ASHAQKYFIR  180
QLSGGKDKRR SSIHDITTVT IEETNHIHHH HQHHCPPPPP PPPPPPPPPE KDAPQLAGFI  240
PSSSALGVSQ LDFDLHGLRL GAPHHHHHHH NHIFKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1715771173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016443176.11e-102PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-86DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLS8C0110.0S8C011_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000492091e-100(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-88MYB family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]