PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB
Protein Properties Length: 307aa    MW: 35230.2 Da    PI: 6.1237
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57330.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.4e-192774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd++l+d+v  +G g+W+tI+r  g+ R++k+c++rw +yl
       EPS57330.1 27 RGLWSPEEDQKLIDYVSTYGHGCWSTIPRLAGLQRCGKSCRLRWINYL 74
                     788*******************************************97 PP

2Myb_DNA-binding513.4e-1680122145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++T++E  l++++++ lG++ W+ Ia++++ gRt++++k++w+
       EPS57330.1  80 RGNFTPQEAALIIELHRILGNR-WSQIAKYLP-GRTDNEVKNFWN 122
                      89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-261877IPR009057Homeodomain-like
PROSITE profilePS5129425.5752278IPR017930Myb domain
SuperFamilySSF466893.55E-3124121IPR009057Homeodomain-like
SMARTSM007172.2E-142676IPR001005SANT/Myb domain
PfamPF002491.3E-162774IPR001005SANT/Myb domain
CDDcd001672.46E-123074No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2578129IPR009057Homeodomain-like
PROSITE profilePS5129420.80279129IPR017930Myb domain
SMARTSM007177.0E-1679127IPR001005SANT/Myb domain
PfamPF002491.0E-1480123IPR001005SANT/Myb domain
CDDcd001671.69E-1182122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MASSSSSSSS SSSGHHHTCC NRQKVKRGLW SPEEDQKLID YVSTYGHGCW STIPRLAGLQ  60
RCGKSCRLRW INYLRPDVKR GNFTPQEAAL IIELHRILGN RWSQIAKYLP GRTDNEVKNF  120
WNSSIKKKLL AHARHCRSSD LYLPQTKPNS HQAFIPNPPP ECIVNNDVNL LLPPPAPATW  180
YDTPRVPGDR NQQREEEEKP PHAFTAAGFD YDLDKEILEA LLPELDSEKS MSMCFEEEEE  240
EEEAPPFWSL LREQQQDEED ERFFFPGPET NHHHHHHHHP YHIDNITALI ASFTSSDPPP  300
PPEMDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32271297108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLS8BS030.0S8BS03_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-73myb domain protein 26
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]