PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_40387_BGI-A2_v1.0
Common NameF383_21585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 320aa    MW: 35601.7 Da    PI: 7.0674
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_40387_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.7e-33184239156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+rFvea++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cotton_A_40387_BGI-A2_v1.0 184 KQRRCWSPELHRRFVEALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 239
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.019181241IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-30181242IPR009057Homeodomain-like
SuperFamilySSF466894.03E-19182242IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-27184239IPR006447Myb domain, plants
PfamPF002492.0E-8186237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MKKIDAFKRE LPLCMLLLKD GIERLKEEER QCKEMNDGSV TEENGRETMD NDGGDKKNWM  60
SSVQLWNSNF NNVDPHNKPN TVPELKLTSE EGEDGSESEN PIEICNKQRK GGAFVPFKEQ  120
ADKKVSGLSL MTPSSELASC ILKNNGGCRI GSGFSLYAQQ NQIKFQTKSQ IRHEEQPQQQ  180
NSRKQRRCWS PELHRRFVEA LQQLGGSQVA TPKQIRELMQ VDGLTNDEVK SHLQKYRLHI  240
RKLPASSSGQ GNELCSAQNQ CNGKMKASMS QSGSPQGPLL GSASAKDMSS TGGDSMDTED  300
ENSDGHSWRS GIKKPGEVDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-15184237154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-15184237154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-15184237154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-15184237154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5803181e-116JX580318.1 Gossypium hirsutum clone NBRI_GE12725 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017634810.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A0B0NV130.0A0A0B0NV13_GOSAR; Two-component response regulator ARR1-like protein
STRINGGorai.008G073300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-55G2-like family protein