PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_39756_BGI-A2_v1.0
Common NameF383_01607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 653aa    MW: 70985.1 Da    PI: 6.9712
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_39756_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093694061954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Cotton_A_39756_BGI-A2_v1.0 369 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 406
                                 554459******************************88 PP

2BELL121.14.7e-39230301172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 e+qe+q+kkakL+++l+eV++rY+qy++q+q+v ssFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  Cotton_A_39756_BGI-A2_v1.0 230 EKQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVTSSFEQAAGIGSAKTYTALALKTISKQFRCLKDAISDQI 301
                                 689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.7E-65148299IPR006563POX domain
PfamPF075263.8E-49155298IPR006563POX domain
PROSITE profilePS5007112.195347410IPR001356Homeobox domain
SMARTSM003895.3E-9350414IPR001356Homeobox domain
CDDcd000866.69E-12350411No hitNo description
SuperFamilySSF466898.13E-17351416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-29353416IPR009057Homeodomain-like
PfamPF059202.7E-18367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MSTYFHGNPE IQASTDGLQT LVLMNPAYVQ YSDTPPPPPA NNLLFFNPNS LSPPQTQQLV  60
GIPLPATSAA NQGPTSHDIS PLHGLVQRVH YNLYNPIDPS GSARETPRSQ QGLSLTLSSQ  120
QQPGYGSQAQ AVSGGSASSG SGVHNRVSGV QSVFLSSKYL KAAQELLDEV VNVNTTGITK  180
SELLAKKGGG GNNHSNSSSK AVGESSVVAG DGSGGGEAGE KHPAELTTAE KQEIQMKKAK  240
LINMLDEVEQ RYRQYHHQMQ IVTSSFEQAA GIGSAKTYTA LALKTISKQF RCLKDAISDQ  300
IRAANKSLGE EEDGVGGAAK IEGSRLKFVD HHLRQQRALQ QLGMIQHNAW RPQRGLPERS  360
VSVLRAWLFE HFLHPYPKDS DKHMLAKQTG LTRSQVSNWF INARVRLWKP MVEEMYLEEI  420
KEQEQNGTSD DKTSKTENHE DSASKSTAPS CQNPGENQKV SLMSISTAST SPLAGNAHQQ  480
SRFSLIGSSE LEGINQGSPK KPRSNELLQS PSSVPSMNMD MNQSEASNEV SMKFSKDGYS  540
FMGTNTDFMG GLGQYPIGEI GRFDAEQFAP RFPGNGVSLT LGLPHCENLS LSGTHQNFLP  600
NQTMQMGRRL DIDEPNEFGA INPPTPHSSA AYESINLQNR KRFVAQLLPD FVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16356414563Homeobox protein Meis2
3k2a_B3e-16356414563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441572.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012441571.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012441570.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0B0NLF40.0A0A0B0NLF4_G
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-162BEL1-like homeodomain 1