PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_39419_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 256aa    MW: 29490.6 Da    PI: 10.3407
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_39419_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.93.6e-151150342
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                i n+s r+ t+ kR++g++KK +ELS+ C+++++ i+ s+
  Cotton_A_39419_BGI-A2_v1.0 11 ITNDSSRKATYKKRKKGLMKKMSELSTFCGINACAIMCSH 50
                                89***********************************997 PP

2SRF-TF42.77e-14165204443
                                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                      SRF-TF   4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 
                                  n+s r+ t+ kR+ng +KK +ELS+LC+++ + i+ s+ 
  Cotton_A_39419_BGI-A2_v1.0 165 TNDSSRKATYKKRKNGFMKKVSELSTLCGVNGCSIMCSPY 204
                                 5999********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.0E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.04149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.06E-18173IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-7323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-72338IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-8104213IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-17164246IPR002100Transcription factor, MADS-box
CDDcd002661.35E-20165238No hitNo description
PfamPF003194.5E-14165204IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.395166202IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MIRKKVKLAY ITNDSSRKAT YKKRKKGLMK KMSELSTFCG INACAIMCSH YESQPEVWLS  60
PISSTSALQV QDDPEMEQRK NMVNYERKSS SSSLSMVALP PMTMVMPKVM LRASTEDIMQ  120
LDMNSMDPIK RQQWIMVLMN NNNSNPQTHV GGNEMMFSWD WCVTTNDSSR KATYKKRKNG  180
FMKKVSELST LCGVNGCSIM CSPYESQFEA WLSPIGVEQV LSKFKMIPKM ERRKNMVNQE  240
SFLPRRTIKI VKQLKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYITNDSSRKATYKKRK
22125KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017640192.13e-38PREDICTED: agamous-like MADS-box protein AGL80
SwissprotO808054e-21PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLA0A2P5Y1K24e-67A0A2P5Y1K2_GOSBA; Uncharacterized protein
STRINGGorai.011G189000.12e-49(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.11e-23M-type_MADS family protein
Publications ? help Back to Top
  1. Raissig MT,Bemer M,Baroux C,Grossniklaus U
    Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2.
    PLoS Genet., 2013. 9(12): p. e1003862
    [PMID:24339783]
  2. Jeong CW, et al.
    Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm.
    PLoS ONE, 2015. 10(2): p. e0117431
    [PMID:25689861]
  3. Burkart-Waco D,Ngo K,Lieberman M,Comai L
    Perturbation of parentally biased gene expression during interspecific hybridization.
    PLoS ONE, 2015. 10(2): p. e0117293
    [PMID:25719202]
  4. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]