PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_38864_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 367aa    MW: 40347.7 Da    PI: 7.5535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_38864_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32200255156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W++eLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cotton_A_38864_BGI-A2_v1.0 200 KQRRCWSSELHKRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 255
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.248197257IPR017930Myb domain
SuperFamilySSF466893.98E-18198258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28198258IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27200255IPR006447Myb domain, plants
PfamPF002493.3E-7202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDYAQKMRKC HEYVEALEEE RRKIQVFQRE LPLCFELVTQ AIESCKKEMY MQGQSECSEQ  60
TSSDSPVLEE FIPIKRSCNC SEEDDDDDDE NVAAADKKKS DWLRSVQLWN PPSKEDVGKT  120
GSGVQMKGNG GAFQPFHKEK GNVEKKSVEA VGKGNASATA TTTTSASTTE SGSRGIAADD  180
GNTNKKVEKG QQQQQPPQRK QRRCWSSELH KRFLHALQQL GGSHVATPKQ IRELMKVDGL  240
TNDEVKSHLQ KYRLHTRRPS PSINSNGNNP QTPQFVVVGG IWVPPQEYAS VATTAVVSGE  300
TSVTPSPNSG VYAPVAVPLP TLAKPSVQRL QRSQSEDRGS HSEGRVHSNS PSTSSSTHTT  360
TDGFSAF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017618387.10.0PREDICTED: myb family transcription factor EFM
SwissprotQ9FPE81e-103HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A1U8IEU60.0A0A1U8IEU6_GOSHI; transcription factor LUX-like
STRINGGorai.013G080200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-86G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]