PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_37983_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 555aa    MW: 59249.6 Da    PI: 4.2327
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_37983_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.43.7e-29105159155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 kprlrWt+eLH+ Fve+ ++LGG+++AtPk++l+lm+++gL l hvkSHLQkYRl
  Cotton_A_37983_BGI-A2_v1.0 105 KPRLRWTSELHSYFVEVCNRLGGPQRATPKAVLDLMDIDGLNLFHVKSHLQKYRL 159
                                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-25103159IPR009057Homeodomain-like
SuperFamilySSF466893.94E-14105159IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-21105160IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MGEILSELNS VSVENNVVSQ NSDEFKVSVF GEQVLAGQGV HVNGHNQHDQ QLHQGGGNNN  60
TLLALQEIPG NLPPFTVSNG DPVFGNEVVE RVREKPKLIV TNDIKPRLRW TSELHSYFVE  120
VCNRLGGPQR ATPKAVLDLM DIDGLNLFHV KSHLQKYRLG KYADKDSTEG GQTGTFGSSS  180
SAIPLPLCTN QYNSLTCSQM SIQDMGAKKL EAERNVQRCL EEQRRYLQTA LERACKTLAN  240
QYLGDAAAVE NAILYGQASA GLGNFATIPV GPSGFGTSAT RVPPFYSEQQ NAYPTYNNTL  300
TTPANLGLQE QPVGYQLQTS FSPAPQGNIS TSNGYSGSSP HQETLAAAAA YTDWLVDEDL  360
IQTSFSPATQ GNISTSNGYS GSSPHQETSA AAAADTDWLV DEDLIQTSFS PAPQGNISTS  420
NGYSGSSPHQ ETSAAAAANM DRPVDKDLIQ TSFSPAPQGN ISTSNGYSGS SPHQETSAAA  480
AADTDWPVDE DLIQTSFSPA PQGNISTSNG YSGSAPHQET SAAAAADIDW PVDEDLIQAF  540
FNWDDNEPMN LDASL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-20105162158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-20105162158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-20105162158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-20105162158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-20105162259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017634379.10.0PREDICTED: uncharacterized protein LOC108476618
TrEMBLA0A0D2NCU60.0A0A0D2NCU6_GOSRA; Uncharacterized protein
STRINGGorai.001G225500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2194955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-31G2-like family protein