PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_36642_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 238aa    MW: 26708.6 Da    PI: 10.835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_36642_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.86.8e-3095148255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk++tl+hvkS LQ+YR+
  Cotton_A_36642_BGI-A2_v1.0  95 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDITLAHVKSQLQMYRT 148
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.84E-1492149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-2693149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2195148IPR006447Myb domain, plants
PfamPF002497.1E-696147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MRTIPFPDLS LQISPTSISV CRVKGMTYYR SSTTDSSCSG ANLSQGQPRL SLGFETAVLS  60
QSQPKLNHHQ PQIYGREFKR NARMINGVKR RMRAPRMRWT TTLHAHFVHA VQLLGGHERA  120
TPKSVLELMN VKDITLAHVK SQLQMYRTVK STDKGSANLQ TSPQRTQSDP WLSSMETNNL  180
IISGHGNSFT FKSNDAKVKV DKAELQVSNR LKDRLDSNSL SPSHMLLNLE FTLGMPLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1596150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1596150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1596150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1596150357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1596150458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2834722e-71KP283472.1 Prunus armeniaca aberrant testa shape (ATS) gene, complete cds.
GenBankKP2834732e-71KP283473.1 Prunus incisa isolate 462-2010A aberrant testa shape (ATS) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017625086.11e-175PREDICTED: probable transcription factor KAN4
TrEMBLA0A0D2SEB11e-154A0A0D2SEB1_GOSRA; Uncharacterized protein
STRINGGorai.005G105600.11e-155(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-52G2-like family protein