PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_35453_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 376aa    MW: 41569.8 Da    PI: 7.144
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_35453_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32210265156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cotton_A_35453_BGI-A2_v1.0 210 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 265
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-29207268IPR009057Homeodomain-like
PROSITE profilePS5129414.185207267IPR017930Myb domain
SuperFamilySSF466891.99E-18208268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-27210265IPR006447Myb domain, plants
PfamPF002491.5E-7212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDYAQKKRRY HEYVEALEEE RRKIQVFQRE LPLCLELVTQ AIEAHKKEMS GGSTTTDYLQ  60
GQSDCSEQTT SDVPVLEEFI PIKRSSNCSE EDDEQESHKS KETNVPAAVD KRKSDWLRSV  120
QLWNNNQSPD LPLNEDDDKI RSAVEVKKNG GAFQPFQKEK TAEMSGQSAG GKTNGSATST  180
CTTESGSRGG EANNANTSKT EEKEGQASRK QRRCWSPELH RRFLHALQQL GGSHVATPKQ  240
IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS PTVHNNANPQ APQFVVVGGI WVPPPDYSTM  300
TTTTTSTKTA TVTPTSGIYT PVAAPLPALP QPSGTVAQRP QQSHSEERGS HSEGRVQSNS  360
PSISSSTHTT TDSPAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-12210263154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-12210263154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-12210263154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-12210263154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-12210263255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5264432e-63HQ526443.1 Gossypium herbaceum clone NBRI_D2_1421 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017639278.10.0PREDICTED: myb family transcription factor EFM
SwissprotQ9FPE81e-106HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A0D2T8310.0A0A0D2T831_GOSRA; Uncharacterized protein
STRINGGorai.008G185500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-107G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]