PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34547_BGI-A2_v1.0
Common NameF383_11150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 323aa    MW: 35731.1 Da    PI: 9.4757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34547_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.1e-32125178255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cotton_A_34547_BGI-A2_v1.0 125 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 178
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.56E-15122179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28123179IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23125178IPR006447Myb domain, plants
PfamPF002492.0E-7126177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MRTAPFPDLS LQISPPSVSD CKAKEMAYDV LSGKSIYSDR SSTTDSGSSG SDLSHENGYS  60
NPGLGEPTLS LGFEMADLGP PHLQQPRNPH HLHQQHHYQP QIYGRDFKRS ARTMNGGVKR  120
SIRAPRMRWT TTLHAHFVHA VQLLGGHERA TPKSVLELMN VKDLTLAHVK SHLQMYRTVK  180
STDKGSGQGQ TDMSLNQRVG IVDLDGRLSS PKADPNASYS LKISTPSPQT IPRRTQSGSW  240
PSSMETNNFS VSNRGNGLNF KPNDAKVDGD KAVLHMSDRM KERLDSSSMS PSDMFLNLEI  300
TLGRPTWQMD YAESSNELTL LKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17126180458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719891e-103KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017628363.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A0B0NJ580.0A0A0B0NJ58_GOSAR; Putative transcription factor KAN4-like protein
STRINGGorai.009G207200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-66G2-like family protein