PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34432_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 182aa    MW: 20561.2 Da    PI: 9.31
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34432_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57364.91.8e-2060143285
                      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskeh 84 
                                 lfqrl+se+Dei+lL+ ++ + ak+ ++p +d+++fy+fvkk  +++v+k q+++K++ +  K +   +k+ ++ ++s ++  
  Cotton_A_34432_BGI-A2_v1.0  60 LFQRLFSEDDEIALLKSMLAYSAKKVADPCADMNGFYDFVKKLFHIDVTKAQMMDKLKGISGKVESSTDKKIDELSKSSDSLL 142
                                 69*************************************************************99999995555555555544 PP

                      DUF573  85 d 85 
                                 d
  Cotton_A_34432_BGI-A2_v1.0 143 D 143
                                 4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.7E-1561139IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MLSVLFSLFF LFLSFTLSSD RVKYGVLQKR PEKKVGKEGL AIAPVVEEVK KTGEDAKKLL  60
FQRLFSEDDE IALLKSMLAY SAKKVADPCA DMNGFYDFVK KLFHIDVTKA QMMDKLKGIS  120
GKVESSTDKK IDELSKSSDS LLDKKFGVFD MEVEVVEVGL DMVDGEKKTA LKVKWRKLQM  180
VQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512656e-77JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441856.14e-98PREDICTED: mediator-associated protein 1
TrEMBLA0A0D2TPU47e-84A0A0D2TPU4_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.14e-15DNA-binding storekeeper protein-related transcriptional regulator