PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34375_BGI-A2_v1.0
Common NameF383_25138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 337aa    MW: 36412.1 Da    PI: 5.0658
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34375_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.3e-29165218155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 +prl+Wtp+LH+rFv++v++L G++ A Pkti++lm+v+gLt+e+v+SHLQkYRl
  Cotton_A_34375_BGI-A2_v1.0 165 RPRLVWTPQLHKRFVDVVAHL-GIKSAFPKTIMQLMNVEGLTRENVASHLQKYRL 218
                                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.061162221IPR017930Myb domain
SuperFamilySSF466894.12E-19162222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29164223IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-23166218IPR006447Myb domain, plants
PfamPF002494.8E-8168217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGQEVKMSDF EANGGDDEEA TANAITTIVD DDDDDVEERV IEWEMGLPNC DDLTPLSQSL  60
IPPELASAFS ISPEPRRTVV DVNRASRSTL SSLRSTGAHS STTNNNNSNS NFRDTVVVEA  120
EGYGSGSGSG SDPKKMRKMD IAEEADSAVM TTENSDDPSG RTLKRPRLVW TPQLHKRFVD  180
VVAHLGIKSA FPKTIMQLMN VEGLTRENVA SHLQKYRLYL KRMQGLSNEG PSASDQLFAS  240
TPVPQSLHET GSGGGGGGGS GGGGANGNGN GHLGMAIPMS YGAPMMPVPM PMYGHVGMHQ  300
GLYHQQRQYH HQNGYEANSY GMMQQRDWSD GNRYGSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A5e-34165221157Transcription factor LUX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249259TGSGGGGGGGS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4713331e-110KC471333.1 Bombax ceiba clone 1 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017632126.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB46e-91PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0B0NVP30.0A0A0B0NVP3_GOSAR; Two-component response regulator ARR1-like protein
STRINGGorai.001G112200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.23e-78G2-like family protein
Publications ? help Back to Top
  1. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]