PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34157_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 310aa    MW: 35568 Da    PI: 8.6867
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34157_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092362712055
                                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Cotton_A_34157_BGI-A2_v1.0 236 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 271
                                 5679*****************************885 PP

2ELK30.67.4e-11191212122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ELK+qLl KY+gyL+sLkqE+s
  Cotton_A_34157_BGI-A2_v1.0 191 ELKNQLLWKYRGYLSSLKQELS 212
                                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.7E-204791IPR005540KNOX1
PfamPF037901.3E-214990IPR005540KNOX1
SMARTSM012568.1E-2099150IPR005541KNOX2
PfamPF037913.9E-19105147IPR005541KNOX2
SMARTSM01188750108128IPR005539ELK domain
SMARTSM011881.5E-5191212IPR005539ELK domain
PfamPF037898.8E-8191212IPR005539ELK domain
PROSITE profilePS5121310.423191211IPR005539ELK domain
PROSITE profilePS5007113.005211274IPR001356Homeobox domain
SuperFamilySSF466891.03E-19212287IPR009057Homeodomain-like
SMARTSM003896.2E-12213278IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-27216277IPR009057Homeodomain-like
CDDcd000864.98E-11223275No hitNo description
PfamPF059201.1E-16231270IPR008422Homeobox KN domain
PROSITE patternPS000270249272IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEEYNRVNGN SIPKGNFVYA SPDVATETNT SQNLPKLHLL RDQQEAEDMK AKIIAHPHCS  60
NLFEAYMDCQ KVGAPPEVAA RLAAARQEFE ARRRSAVSST RGTIKDPELD QFMEAYYGML  120
VKYRDELMRP MQEALDFTRR TEAQLNRVSN GLVQIFNSDE KCDGVGSSKE EENNNHSNGG  180
TKTSPRAEDR ELKNQLLWKY RGYLSSLKQE LSKKKKKGKL PKESRQKLLT WWELHYKWPY  240
PSETEKVALA ESTGLDQKQI NNWFINQRKR HWKPSEDSQF MVMDGLHSPN AVLYMDGHYM  300
GGGPYSPGPS
Functional Description ? help Back to Top
Source Description
UniProtAppears to be involved in meristem formation and in the regulation of leaf morphology. Misexpression makes the leaf more compound which is always associated with growth retardation and loss of apical dominance, resulting in dwarfed, bushy plants. Probably binds to the DNA sequence 5'-TGAC-3'.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017633084.10.0PREDICTED: homeotic protein knotted-1-like
RefseqXP_017633085.10.0PREDICTED: homeotic protein knotted-1-like
SwissprotQ413301e-133KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A2P5YHN60.0A0A2P5YHN6_GOSBA; Uncharacterized protein
STRINGGorai.005G098100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.15e-89KNOTTED-like from Arabidopsis thaliana