PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_34107_BGI-A2_v1.0
Common NameF383_32281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 312aa    MW: 35491.9 Da    PI: 4.8857
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_34107_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-082452782255
                                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                  +yp++e++ +L++ +gL+++q+ +WF N+R ++
  Cotton_A_34107_BGI-A2_v1.0 245 WPYPTEEDKLKLSEITGLDQKQINNWFINQRKRH 278
                                 58*****************************885 PP

2ELK37.16.8e-13198219122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ++K +L+rKYsgyL+sL++EF+
  Cotton_A_34107_BGI-A2_v1.0 198 DIKGMLMRKYSGYLSSLRKEFL 219
                                 58*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.3E-1760104IPR005540KNOX1
PfamPF037903.1E-1862102IPR005540KNOX1
SMARTSM012562.1E-24107158IPR005541KNOX2
PfamPF037911.5E-24110157IPR005541KNOX2
PROSITE profilePS5121310.58198218IPR005539ELK domain
PfamPF037891.1E-9198219IPR005539ELK domain
SMARTSM011882.4E-6198219IPR005539ELK domain
PROSITE profilePS5007112.276218281IPR001356Homeobox domain
SMARTSM003891.2E-12220285IPR001356Homeobox domain
SuperFamilySSF466892.35E-19220290IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-27223283IPR009057Homeodomain-like
CDDcd000864.33E-12230282No hitNo description
PfamPF059206.7E-17238277IPR008422Homeobox KN domain
PROSITE patternPS000270256279IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEDLYRLDDP IISCSNGIAR VNNFATPNFT ATDFLSPVDH LLQFDDQEVD TDATGSHMSG  60
LIKSQISNHP RYLNLVSAYI ECQKVGAPPK LASLLEEIGR ENRSVNACSE IGADPELDEF  120
MESYCEVLHR YKEELSKPFN EATTFLSNIK SQLSDLCKEA LTKNLDYPFD EGGGSSVEEL  180
SGGEVEGFEN QDECGRQDIK GMLMRKYSGY LSSLRKEFLK KRKKGKLPKE ARVTLLDWWN  240
NHYRWPYPTE EDKLKLSEIT GLDQKQINNW FINQRKRHWK PSEDMKFALM EGFAGDPMHF  300
GHGVGPGSDN IC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213222LRKEFLKKRK
2219223KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017609098.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP292e-90KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0B0MZZ00.0A0A0B0MZZ0_GOSAR; Homeobox protein knotted-1-like 1
STRINGGorai.013G129400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.14e-72KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Park SH, et al.
    A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts, in rice.
    Planta, 2007. 227(1): p. 1-12
    [PMID:17624547]