PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_33973_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 405aa    MW: 45679.7 Da    PI: 7.2183
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_33973_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-093333672155
                                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                 k +yps++++  LA+++gL+++q+ +WF N+R ++
  Cotton_A_33973_BGI-A2_v1.0 333 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 367
                                 569*****************************885 PP

2ELK40.94.2e-14287308122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ELK qLlrKYsgyLgsLkqEF+
  Cotton_A_33973_BGI-A2_v1.0 287 ELKGQLLRKYSGYLGSLKQEFM 308
                                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.8E-20103147IPR005540KNOX1
PfamPF037903.3E-22105143IPR005540KNOX1
SMARTSM012564.9E-27152203IPR005541KNOX2
PfamPF037914.8E-21155202IPR005541KNOX2
PfamPF037896.9E-11287308IPR005539ELK domain
PROSITE profilePS5121311.174287307IPR005539ELK domain
SMARTSM011882.8E-8287308IPR005539ELK domain
PROSITE profilePS5007112.989307370IPR001356Homeobox domain
SuperFamilySSF466891.8E-19309384IPR009057Homeodomain-like
SMARTSM003897.4E-13309374IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-28312372IPR009057Homeodomain-like
CDDcd000862.21E-12319371No hitNo description
PfamPF059207.6E-17327366IPR008422Homeobox KN domain
PROSITE patternPS000270345368IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEGGSSSTSC MMAFGHNSNG LCPMTMMHHP MTSHLHPQHQ HHHHHPNSGS SSLFLPQPPT  60
NNQDQNHNSS SGSSMILDDQ HNTTTSNNNN TGCYFMESND GSSSVKAKIM AHPHYHRLLA  120
AYVNCQKVGA PPEMVARLEE ACASAATMGP TRTGCIGEDP ALDQFMEAYC EMLTKYEQEL  180
TKPFKEAMLF LQRVECQFKA LTVSSPNPDC RVKEYLGQRT TLLPSLVAKS SENGITMETI  240
YAALLARASL HHVVRKACGE GVDRNALSEE DVDVNNNFID PLAEDRELKG QLLRKYSGYL  300
GSLKQEFMKK RKKGKLPKEA RQQLLDWWSR HYKWPYPSES QKLALAESTG LDQKQINNWF  360
INQRKRHWKP SEDMQFVVMD AAHPHYYMDN VLGNPFPMDL SPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1302311LKQEFMKKRK
2308312KKRKK
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator involved in early embryonic development. Probably binds to the DNA sequence 5'-TGAC-3'.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017645016.10.0PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-148HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A2P5YBT60.0A0A2P5YBT6_GOSBA; Uncharacterized protein
STRINGGorai.010G183800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64732644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Shu Y, et al.
    GmSBH1, a homeobox transcription factor gene, relates to growth and development and involves in response to high temperature and humidity stress in soybean.
    Plant Cell Rep., 2015. 34(11): p. 1927-37
    [PMID:26205508]