PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_33962_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 121aa    MW: 13475.3 Da    PI: 9.4723
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_33962_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.64.8e-18231031598
                                 -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                          B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                                  +++p +fa+e ++ +e     +++d++gr+We+++ ++ ks  + l++GW++Fv++n+L++gD++ F+++ +++   ++k++
  Cotton_A_33962_BGI-A2_v1.0  23 SVSVPASFAKETSLAEEP--STVIKDSEGRKWEINILVDAKS-NVRLGAGWSQFVQENKLEAGDTISFQHIPNTGNVIYFKII 102
                                 4799********888654..47779***********877777.579************************9888887888887 PP

                                 - CS
                          B3  98 r 98 
                                 +
  Cotton_A_33962_BGI-A2_v1.0 103 S 103
                                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.49E-17896IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-19993IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.8749105IPR003340B3 DNA binding domain
CDDcd100173.05E-171195No hitNo description
SMARTSM010191.8E-1012105IPR003340B3 DNA binding domain
PfamPF023621.1E-1523104IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MLQVPSVPKD SFVVVLKKYH QYSVSVPASF AKETSLAEEP STVIKDSEGR KWEINILVDA  60
KSNVRLGAGW SQFVQENKLE AGDTISFQHI PNTGNVIYFK IISNARAANY GDGRNMRKNV  120
C
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469509.12e-43PREDICTED: putative B3 domain-containing protein Os03g0621600
TrEMBLA0A0B0PZA28e-75A0A0B0PZA2_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14995620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.11e-10DNA binding;DNA binding;sequence-specific DNA binding transcription factors