PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32708_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 669aa    MW: 74328.2 Da    PI: 6.5671
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32708_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox14.46.8e-054254631954
                                 HHH..SSS--HHHHHHHHHHCTS-HHH.HHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterq.VkvWFqNrRak 54 
                                 Fe   ++yps  ++  LA+++gL+ +q  ++WF N R +
  Cotton_A_32708_BGI-A2_v1.0 425 FEHflHPYPSDVDKHILARQTGLSRSQaCSNWFINARVR 463
                                 554459******************998569*******88 PP

2BELL1147.8e-37287357272
                        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 ++elq++k+k+ls+leeVd+rYk y++q+++v+ssFeavag g+a +Y +lA+ka+SrhFrcL+d ia+qi
  Cotton_A_32708_BGI-A2_v1.0 287 FTELQRRKTKMLSMLEEVDRRYKIYCDQMKAVVSSFEAVAGTGAASVYSALASKAMSRHFRCLRDGIASQI 357
                                 679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-57222355IPR006563POX domain
PfamPF075261.3E-46228354IPR006563POX domain
CDDcd000864.09E-8406468No hitNo description
SMARTSM003890.0019406471IPR001356Homeobox domain
SuperFamilySSF466893.17E-13407473IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-24409473IPR009057Homeodomain-like
PfamPF059206.3E-15423463IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MARESCEDKS RNIVSSTGFC YSDVSSGNST MQTHLVNQIQ GFESNPEIFN LTTGMEMIGF  60
AKNLHQQQGD TNNMIMWKGF SNKHGNNPGA AGPSSSSSKP INESTTDFYQ HEFHKPEFTT  120
GISETSTGNL IVGPESAPWQ ENRLLVDDSS FRCVFPCEGN ERPSQGLSLS LSSSNPTSIG  180
LQSFELRQTS HSNHDDQPDD MRFIGSSSRD GFFGKPAIVQ QHQAQFQIRG SRYLNAAQEL  240
LNEFCSLGAK QLDTSKQKQT QKTTKQWDDD DGGASSSRKQ SLYSLDFTEL QRRKTKMLSM  300
LEEVDRRYKI YCDQMKAVVS SFEAVAGTGA ASVYSALASK AMSRHFRCLR DGIASQIQAT  360
RKAMGEKDTV APGTTKGETP RLRILDQALR QQRAFQQMSM MESHPWRPQR GLPERSVSVL  420
RAWLFEHFLH PYPSDVDKHI LARQTGLSRS QACSNWFINA RVRLWKPMVE EMYLEETKEH  480
ENNMDSSDNG GTDGGDDNNN NGRLNIPLAD QKPTPDQLVR VDSECLSSII TTNPEKNDGK  540
SGTKTLENQH LHHHHHHHQQ QSFGTYGATA MELDFASYGD HTAGGGVPYH NANQSFNGGG  600
GVSLTLGLQQ HGGSGVSLAF SPATQTSLFY PRDHIEDCQP VQYSLLDNEG QHLPYRNLMG  660
AQLLHDLAG
Functional Description ? help Back to Top
Source Description
UniProtPlays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269|PubMed:12244239, ECO:0000269|PubMed:17693535, ECO:0000269|PubMed:22786869}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6144970.0JX614497.1 Gossypium hirsutum clone NBRI_GE57913 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017603659.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_017603660.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_017603661.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-144BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A1U8NMQ30.0A0A1U8NMQ3_GOSHI; homeobox protein BEL1 homolog
STRINGGorai.008G248900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-140TALE family protein
Publications ? help Back to Top
  1. Yamada T,Sasaki Y,Hashimoto K,Nakajima K,Gasser CS
    CORONA, PHABULOSA and PHAVOLUTA collaborate with BELL1 to confine WUSCHEL expression to the nucellus in Arabidopsis ovules.
    Development, 2016. 143(3): p. 422-6
    [PMID:26700684]
  2. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]