PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32643_BGI-A2_v1.0
Common NameF383_17633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 372aa    MW: 43285.6 Da    PI: 9.5089
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32643_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.31.4e-18596198
                                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
                                ff +l+ s +l+++ l++p +f++++g +   s+   l+ ++g +W+v +  rk ++++++ +GW+eFv+  ++++g  +vF+++
  Cotton_A_32643_BGI-A2_v1.0  5 FFHKLILSTTLQHKKLRIPDNFVKKFGDE--LSVAAALTVPDGHVWRVGI--RKADNKVWFHEGWQEFVERYHIRVGYLLVFRYE 85
                                8899999******************9865..99*****************..********************************* PP

                                SSSEE..EEEEE- CS
                          B3 86 grsefelvvkvfr 98
                                g+s+f   v++f+
  Cotton_A_32643_BGI-A2_v1.0 86 GNSCF--SVSIFS 96
                                *****..888875 PP

2B360.43e-19242333499
                                 E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                                 vl ps+  + ++++lp  fae++ +g++     ++l+ ++gr+W ++++yr+++    +++GW eF  +n+L egD+++F+l 
  Cotton_A_32643_BGI-A2_v1.0 242 VLRPSYLYRGCIMYLPSCFAEKYlSGVSG---FIKLQLPDGRQWPIRCRYRGGK--AKFSQGWYEFTLENNLGEGDVCIFELL 319
                                 78899******************866743...5***************555555..6699**********************9 PP

                                 SSSEE..EEEEE-S CS
                          B3  86 grsefelvvkvfrk 99 
                                 +++ef l+v+vfr 
  Cotton_A_32643_BGI-A2_v1.0 320 RSREFVLKVTVFRV 333
                                 99*********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.7E-23396IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-22396IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.846598IPR003340B3 DNA binding domain
CDDcd100172.50E-20596No hitNo description
PfamPF023621.1E-15596IPR003340B3 DNA binding domain
SMARTSM010196.0E-18698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.1E-24230332IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-24232332IPR015300DNA-binding pseudobarrel domain
CDDcd100176.05E-22237332No hitNo description
PROSITE profilePS5086313.888239334IPR003340B3 DNA binding domain
SMARTSM010191.1E-22239334IPR003340B3 DNA binding domain
PfamPF023623.8E-17242332IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MPRPFFHKLI LSTTLQHKKL RIPDNFVKKF GDELSVAAAL TVPDGHVWRV GIRKADNKVW  60
FHEGWQEFVE RYHIRVGYLL VFRYEGNSCF SVSIFSLYNS EINYQTNAFV GTQYYHRKPY  120
PFEELEDDEC ISPALQNLFS ASKVNNCMNW SGEINFRALK GMNSQSFRGA VLPKPNKPGR  180
KKQKFDHAEP DSSVGQEYDV YTNFRLYESA SARKRSVTTE ERERAINAAK SFEPMNPFCR  240
VVLRPSYLYR GCIMYLPSCF AEKYLSGVSG FIKLQLPDGR QWPIRCRYRG GKAKFSQGWY  300
EFTLENNLGE GDVCIFELLR SREFVLKVTV FRVRESAPVS MKCRPELNQL TYSEHILPDD  360
VKPIRVNKSM PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A7e-7420533515144B3 domain-containing transcription factor VRN
4i1k_B7e-7420533515144B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9296950.0GU929695.1 Gossypium hirsutum reduced vernalization response 1 (V1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458780.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1
SwissprotQ8L3W11e-148VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A0B0MJ830.0A0A0B0MJ83_G
STRINGPOPTR_0009s11170.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112428103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-149B3 family protein