PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32505_BGI-A2_v1.0
Common NameF383_09261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 529aa    MW: 57675.4 Da    PI: 7.1319
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32505_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.82.1e-134180242
                         TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                                ++k+CnCk+s+Clk+YCeCf++g +C+  C+C +C+N+ e+
  Cotton_A_32505_BGI-A2_v1.0 41 KQKQCNCKNSRCLKLYCECFSSGFYCNG-CNCLNCHNNVEN 80
                                89**************************.********9875 PP

2TCR50.44.4e-16125164140
                         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                 k++kgC+Ckks+ClkkYCeCf+a+  Cse+CkC dCkN e
  Cotton_A_32505_BGI-A2_v1.0 125 KHNKGCHCKKSSCLKKYCECFQANILCSENCKCMDCKNFE 164
                                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-144080IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.44241165IPR005172CRC domain
PfamPF036382.4E-104277IPR005172CRC domain
SMARTSM011143.3E-19125166IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-12128163IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MQRVPHPVQE LPPQTYQLSK QESPRSRPRV HADAKDGTPK KQKQCNCKNS RCLKLYCECF  60
SSGFYCNGCN CLNCHNNVEN EAARQEAVGT TLERNPNAFR PKIASSPHRP QDTRDDAHDV  120
QMVGKHNKGC HCKKSSCLKK YCECFQANIL CSENCKCMDC KNFEGSEERR ALVHGDHNSM  180
AYMQQANAAI SGAVGSSGFG IPATSKKRKS EEIIFGLAVK DQSVHKIVQQ QQQENHIRDL  240
LATCSPLSAH LSGTANKASL GSSKFSYRSP LANILQPQYV KELCSVLVLV SSEAGRALAA  300
EKSGKKDQQA KGDSIETTVS SNQMHEMSEN GNGVLSSATD DCESENHGDA NRSGDCGANE  360
DSVQNGMPLS PRTRALMCDE EDTMFMAVGS PDLLTDPSQN ITQKSLNGHE CTEVYAEQES  420
LVLTVFRDFL NQLITRGSIK ETRCFPSPLS EKRSEQEPAE NGAIKSGNRA VGQKQPYPNG  480
TVKSLNPAPA EISQTLSAAT SVLNTDLPLK HESSIGKEDT KNVGIEGSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-294217411132Protein lin-54 homolog
5fd3_B1e-294217411132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6225212e-76JX622521.1 Gossypium hirsutum clone NBRI_GE69283 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017643333.10.0PREDICTED: protein tesmin/TSO1-like CXC 6 isoform X1
RefseqXP_017643334.10.0PREDICTED: protein tesmin/TSO1-like CXC 6 isoform X2
SwissprotQ9SZD11e-143TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0B0PI040.0A0A0B0PI04_GOSAR; Protein lin-54
STRINGGorai.010G108300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-133Tesmin/TSO1-like CXC domain-containing protein